PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do025480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family BBR-BPC
Protein Properties Length: 294aa    MW: 32387.7 Da    PI: 10.02
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do025480.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind377.42.4e-115129426301
   GAGA_bind  26 lqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla...salpvgvq.vlsgtksidslqqlse.... 116
                 ++l+++++e+d++irer++al+ekkaa+aerdmaf+qrd+a+aern+a+verdn+l+al+l++++     + +++ ++  l+gtk+i++++qls+    
  Do025480.1   1 MNLLALMNEKDSAIRERDHALAEKKAAIAERDMAFAQRDAAMAERNAAIVERDNALAALELARTNGFnmnNGNGFHQGpPLNGTKNIHHHDQLSHvqts 99 
                 689********************************************************99888765433444444432589**********9998999 PP

   GAGA_bind 117 .pqledsave.lreeeklealpieeaaeeakekkkkkkrqrakkpkekkak..kkkkksekskkkvkkesader......skaekksidlvlngvslDe 205
                   ql+ds+++ +re +++ea+pi +a+ ++ + kk++k++++++p+++ +   +k+kk+++++k+  ++  +e+      +k+e+k++dl+ln+vs+De
  Do025480.1 100 pLQLADSPYDhTREVHISEAYPIATAPGSIGKGKKPRKNSSQASPLKRPSGvlRKTKKPASEWKSGGMSVGREDsvrasvMKNEWKDQDLGLNQVSFDE 198
                 99********9*************************************99988777889999999888876533688888******************* PP

   GAGA_bind 206 stlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                 st+P+P+CsCtG lrqCYkWGnGGWqS+CCt+++S+yPLPv+++rr+aR++grKmS++af+klL++LaaeG+dls+pvDLkdhWAkHGtn+++tir
  Do025480.1 199 STMPAPACSCTGELRQCYKWGNGGWQSSCCTMSMSMYPLPVMPNRRHARMGGRKMSGSAFTKLLSRLAAEGHDLSTPVDLKDHWAKHGTNRYITIR 294
                 ***********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.9E-1411294IPR010409GAGA-binding transcriptional activator
PfamPF062179.1E-942294IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MNLLALMNEK DSAIRERDHA LAEKKAAIAE RDMAFAQRDA AMAERNAAIV ERDNALAALE  60
LARTNGFNMN NGNGFHQGPP LNGTKNIHHH DQLSHVQTSP LQLADSPYDH TREVHISEAY  120
PIATAPGSIG KGKKPRKNSS QASPLKRPSG VLRKTKKPAS EWKSGGMSVG REDSVRASVM  180
KNEWKDQDLG LNQVSFDEST MPAPACSCTG ELRQCYKWGN GGWQSSCCTM SMSMYPLPVM  240
PNRRHARMGG RKMSGSAFTK LLSRLAAEGH DLSTPVDLKD HWAKHGTNRY ITIR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1847590.0KF184759.1 Saccharum hybrid cultivar R570 clone BAC 015H09 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001141822.10.0BBR/BPC transcription factor
RefseqXP_008658294.10.0PREDICTED: BBR/BPC transcription factor isoform X1
SwissprotQ5VSA80.0BBRD_ORYSJ; Barley B recombinant-like protein D
TrEMBLB4FYC00.0B4FYC0_MAIZE; BBR/BPC transcription factor
TrEMBLK3XYG40.0K3XYG4_SETIT; Uncharacterized protein
STRINGSi006972m0.0(Setaria italica)
STRINGGRMZM2G118690_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62263756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.22e-95basic pentacysteine 6